Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 376082..376836 | Replicon | chromosome |
Accession | NZ_CP098227 | ||
Organism | Escherichia coli strain XJ6-3 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | KFZ54_RS01705 | Protein ID | WP_001301452.1 |
Coordinates | 376082..376567 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | KFZ54_RS01710 | Protein ID | WP_000801912.1 |
Coordinates | 376558..376836 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KFZ54_RS01685 (371249) | 371249..372007 | + | 759 | WP_000815099.1 | DeoR/GlpR family transcriptional regulator | - |
KFZ54_RS01690 (371989) | 371989..373587 | - | 1599 | WP_088375916.1 | DNA-binding transcriptional regulator RtcR | - |
KFZ54_RS01695 (373774) | 373774..375000 | + | 1227 | WP_001105483.1 | RNA-splicing ligase RtcB | - |
KFZ54_RS01700 (375004) | 375004..376032 | + | 1029 | WP_097756021.1 | RNA 3'-terminal phosphate cyclase | - |
KFZ54_RS01705 (376082) | 376082..376567 | - | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
KFZ54_RS01710 (376558) | 376558..376836 | - | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
KFZ54_RS01715 (376903) | 376903..379608 | - | 2706 | WP_097756020.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T247246 WP_001301452.1 NZ_CP098227:c376567-376082 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|