Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 4512..5059 Replicon plasmid pZ0117EC0005-2
Accession NZ_CP098225
Organism Escherichia coli strain Z0117EC0005

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NBY12_RS23825 Protein ID WP_244449344.1
Coordinates 4781..5059 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E2GHF7
Locus tag NBY12_RS23820 Protein ID WP_012881119.1
Coordinates 4512..4781 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY12_RS23790 (486) 486..872 + 387 Protein_1 DUF2726 domain-containing protein -
NBY12_RS23795 (1027) 1027..1500 + 474 WP_016240489.1 hypothetical protein -
- (1643) 1643..1702 - 60 NuclAT_1 - -
- (1643) 1643..1702 - 60 NuclAT_1 - -
- (1643) 1643..1702 - 60 NuclAT_1 - -
- (1643) 1643..1702 - 60 NuclAT_1 - -
NBY12_RS23800 (1747) 1747..1896 + 150 WP_001312851.1 Hok/Gef family protein -
NBY12_RS23805 (2181) 2181..2429 + 249 WP_000083839.1 replication regulatory protein RepA -
NBY12_RS23810 (2674) 2674..2748 + 75 WP_001365705.1 RepA leader peptide Tap -
NBY12_RS23815 (2741) 2741..3598 + 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
NBY12_RS23820 (4512) 4512..4781 + 270 WP_012881119.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NBY12_RS23825 (4781) 4781..5059 + 279 WP_244449344.1 type II toxin-antitoxin system toxin YacB Toxin
NBY12_RS23830 (5105) 5105..5953 + 849 WP_012881117.1 3'-5' exonuclease -
NBY12_RS23835 (6070) 6070..6552 + 483 WP_001311056.1 hypothetical protein -
NBY12_RS23840 (6587) 6587..7609 - 1023 Protein_11 maltoporin LamB -
NBY12_RS23845 (7658) 7658..8065 - 408 Protein_12 IS5-like element IS903B family transposase -
NBY12_RS23850 (8145) 8145..9020 - 876 WP_001617865.1 extended-spectrum class A beta-lactamase CTX-M-14 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-14 / erm(B) / aadA5 / qacE / sul1 / mph(A) / aac(3)-IId / blaTEM-1B - 1..57370 57370
- flank IS/Tn - - 237..431 194
- flank IS/Tn blaCTX-M-14 - 8145..10532 2387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10744.34 Da        Isoelectric Point: 8.4615

>T247241 WP_244449344.1 NZ_CP098225:4781-5059 [Escherichia coli]
MEIFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10206.54 Da        Isoelectric Point: 8.8735

>AT247241 WP_012881119.1 NZ_CP098225:4512-4781 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EISRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y1YSD8

References