Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4623431..4624043 | Replicon | chromosome |
| Accession | NZ_CP098223 | ||
| Organism | Escherichia coli strain Z0117EC0005 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NBY12_RS22185 | Protein ID | WP_000833473.1 |
| Coordinates | 4623858..4624043 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | L4IWR9 |
| Locus tag | NBY12_RS22180 | Protein ID | WP_000499744.1 |
| Coordinates | 4623431..4623841 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY12_RS22155 (4619637) | 4619637..4620377 | - | 741 | WP_000906829.1 | MipA/OmpV family protein | - |
| NBY12_RS22160 (4620501) | 4620501..4621475 | + | 975 | WP_000164020.1 | LysR family transcriptional regulator | - |
| NBY12_RS22165 (4621472) | 4621472..4622608 | - | 1137 | WP_000364885.1 | HlyD family secretion protein | - |
| NBY12_RS22170 (4622614) | 4622614..4622937 | - | 324 | WP_000478193.1 | DUF3302 domain-containing protein | - |
| NBY12_RS22175 (4623108) | 4623108..4623434 | + | 327 | WP_129707915.1 | hypothetical protein | - |
| NBY12_RS22180 (4623431) | 4623431..4623841 | - | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NBY12_RS22185 (4623858) | 4623858..4624043 | - | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NBY12_RS22190 (4624321) | 4624321..4625859 | - | 1539 | WP_000183978.1 | aldehyde dehydrogenase AldB | - |
| NBY12_RS22195 (4626060) | 4626060..4627211 | - | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T247240 WP_000833473.1 NZ_CP098223:c4624043-4623858 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT247240 WP_000499744.1 NZ_CP098223:c4623841-4623431 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|