Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3856017..3856671 | Replicon | chromosome |
| Accession | NZ_CP098223 | ||
| Organism | Escherichia coli strain Z0117EC0005 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NBY12_RS18370 | Protein ID | WP_000244781.1 |
| Coordinates | 3856017..3856424 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NBY12_RS18375 | Protein ID | WP_000354046.1 |
| Coordinates | 3856405..3856671 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY12_RS18350 (3851974) | 3851974..3853707 | - | 1734 | WP_032303735.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY12_RS18355 (3853713) | 3853713..3854423 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY12_RS18360 (3854448) | 3854448..3855344 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NBY12_RS18365 (3855456) | 3855456..3855977 | + | 522 | WP_032303736.1 | flavodoxin FldB | - |
| NBY12_RS18370 (3856017) | 3856017..3856424 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NBY12_RS18375 (3856405) | 3856405..3856671 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NBY12_RS18380 (3856923) | 3856923..3857903 | + | 981 | WP_032303737.1 | tRNA-modifying protein YgfZ | - |
| NBY12_RS18385 (3857930) | 3857930..3859228 | + | 1299 | WP_050486624.1 | hypothetical protein | - |
| NBY12_RS18390 (3859225) | 3859225..3859692 | + | 468 | WP_032303738.1 | hypothetical protein | - |
| NBY12_RS18395 (3859723) | 3859723..3860382 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NBY12_RS18400 (3860546) | 3860546..3860857 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T247234 WP_000244781.1 NZ_CP098223:c3856424-3856017 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|