Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1222235..1223072 | Replicon | chromosome |
Accession | NZ_CP098223 | ||
Organism | Escherichia coli strain Z0117EC0005 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | V0SED1 |
Locus tag | NBY12_RS05835 | Protein ID | WP_000227787.1 |
Coordinates | 1222235..1222777 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | NBY12_RS05840 | Protein ID | WP_001353405.1 |
Coordinates | 1222761..1223072 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY12_RS05815 (1217765) | 1217765..1218676 | - | 912 | WP_000705864.1 | 2-dehydropantoate 2-reductase | - |
NBY12_RS05820 (1218844) | 1218844..1219335 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NBY12_RS05825 (1219463) | 1219463..1220827 | - | 1365 | WP_032302573.1 | MFS transporter | - |
NBY12_RS05830 (1221244) | 1221244..1222179 | + | 936 | Protein_1126 | tetratricopeptide repeat protein | - |
NBY12_RS05835 (1222235) | 1222235..1222777 | - | 543 | WP_000227787.1 | GNAT family N-acetyltransferase | Toxin |
NBY12_RS05840 (1222761) | 1222761..1223072 | - | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
NBY12_RS05845 (1223257) | 1223257..1224147 | - | 891 | WP_000971336.1 | heme o synthase | - |
NBY12_RS05850 (1224159) | 1224159..1224488 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NBY12_RS05855 (1224488) | 1224488..1225102 | - | 615 | WP_000179807.1 | cytochrome o ubiquinol oxidase subunit III | - |
NBY12_RS05860 (1225092) | 1225092..1227083 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NBY12_RS05865 (1227105) | 1227105..1228052 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19946.24 Da Isoelectric Point: 8.8951
>T247220 WP_000227787.1 NZ_CP098223:c1222777-1222235 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GE43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |