Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 816199..816749 Replicon chromosome
Accession NZ_CP098223
Organism Escherichia coli strain Z0117EC0005

Toxin (Protein)


Gene name ccdB Uniprot ID A0A2K3TU88
Locus tag NBY12_RS03960 Protein ID WP_032302363.1
Coordinates 816435..816749 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A2K3TUD9
Locus tag NBY12_RS03955 Protein ID WP_032302360.1
Coordinates 816199..816432 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY12_RS03930 (811272) 811272..811559 + 288 WP_000203741.1 ferredoxin-like protein FixX -
NBY12_RS03935 (811619) 811619..812950 + 1332 WP_032302356.1 MFS transporter -
NBY12_RS03940 (813058) 813058..813588 + 531 WP_032183187.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NBY12_RS03945 (813581) 813581..815443 + 1863 WP_032302359.1 glutathione-regulated potassium-efflux system protein KefC -
NBY12_RS03950 (815634) 815634..816113 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
NBY12_RS03955 (816199) 816199..816432 + 234 WP_032302360.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NBY12_RS03960 (816435) 816435..816749 + 315 WP_032302363.1 CcdB family protein Toxin
NBY12_RS03965 (816746) 816746..817594 - 849 WP_000257193.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NBY12_RS03970 (817601) 817601..817978 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NBY12_RS03975 (817981) 817981..818802 - 822 WP_001065391.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NBY12_RS03980 (818799) 818799..819788 - 990 WP_032302365.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NBY12_RS03985 (819788) 819788..821074 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11689.63 Da        Isoelectric Point: 8.0666

>T247218 WP_032302363.1 NZ_CP098223:816435-816749 [Escherichia coli]
MQFTVYRSRGRNAALPFVIDVTSDIIGEINRRIVNPLTPIERFSHIRPPERLNPILLLVDGKEYVLMTHETATVPVNTLG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8557.55 Da        Isoelectric Point: 5.8062

>AT247218 WP_032302360.1 NZ_CP098223:816199-816432 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRNF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K3TU88

Antitoxin

Source ID Structure
AlphaFold DB A0A2K3TUD9

References