Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 11977..12470 Replicon plasmid pZ0117EC0013-2
Accession NZ_CP098221
Organism Escherichia coli strain Z0117EC0013

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NBY13_RS24485 Protein ID WP_001230709.1
Coordinates 12216..12470 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NBY13_RS24480 Protein ID WP_000151456.1
Coordinates 11977..12219 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY13_RS24445 (NBY13_24445) 7230..7832 + 603 WP_077694819.1 transglycosylase SLT domain-containing protein -
NBY13_RS24450 (NBY13_24450) 8129..8950 - 822 WP_001234372.1 DUF932 domain-containing protein -
NBY13_RS24455 (NBY13_24455) 9061..9210 - 150 WP_233337085.1 hypothetical protein -
NBY13_RS24460 (NBY13_24460) 9482..9784 - 303 WP_000379301.1 hypothetical protein -
NBY13_RS24465 (NBY13_24465) 9860..10093 - 234 WP_000093745.1 hypothetical protein -
NBY13_RS24470 (NBY13_24470) 10521..10808 - 288 WP_000606467.1 hypothetical protein -
NBY13_RS24475 (NBY13_24475) 11113..11406 - 294 WP_000673431.1 hypothetical protein -
NBY13_RS24480 (NBY13_24480) 11977..12219 - 243 WP_000151456.1 hypothetical protein Antitoxin
NBY13_RS24485 (NBY13_24485) 12216..12470 - 255 WP_001230709.1 hypothetical protein Toxin
NBY13_RS24490 (NBY13_24490) 12467..13009 - 543 WP_001083904.1 hypothetical protein -
NBY13_RS24495 (NBY13_24495) 13113..13628 - 516 WP_001025393.1 J domain-containing protein -
NBY13_RS24500 (NBY13_24500) 14463..14813 - 351 WP_000127482.1 addiction module antitoxin -
NBY13_RS24505 (NBY13_24505) 14800..15144 - 345 WP_001146936.1 type II toxin-antitoxin system RelE/ParE family toxin -
NBY13_RS24510 (NBY13_24510) 15498..15821 - 324 WP_000432873.1 hypothetical protein -
NBY13_RS24515 (NBY13_24515) 16374..17033 + 660 WP_000516232.1 division plane positioning ATPase MipZ -
NBY13_RS24520 (NBY13_24520) 17123..17425 + 303 WP_001096511.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..51273 51273


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T247211 WP_001230709.1 NZ_CP098221:c12470-12216 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT247211 WP_000151456.1 NZ_CP098221:c12219-11977 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References