Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4042276..4043110 | Replicon | chromosome |
| Accession | NZ_CP098219 | ||
| Organism | Escherichia coli strain Z0117EC0013 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NBY13_RS19490 | Protein ID | WP_001546109.1 |
| Coordinates | 4042733..4043110 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | NBY13_RS19485 | Protein ID | WP_001546108.1 |
| Coordinates | 4042276..4042656 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY13_RS19450 (4038556) | 4038556..4039011 | + | 456 | WP_001545736.1 | IrmA family protein | - |
| NBY13_RS19455 (4039090) | 4039090..4039323 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| NBY13_RS19460 (4039423) | 4039423..4040241 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NBY13_RS19465 (4040296) | 4040296..4040781 | + | 486 | WP_000849588.1 | antirestriction protein | - |
| NBY13_RS19470 (4040797) | 4040797..4041273 | + | 477 | WP_001424026.1 | RadC family protein | - |
| NBY13_RS19475 (4041342) | 4041342..4041563 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NBY13_RS19480 (4041582) | 4041582..4042226 | + | 645 | WP_000086755.1 | hypothetical protein | - |
| NBY13_RS19485 (4042276) | 4042276..4042656 | + | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY13_RS19490 (4042733) | 4042733..4043110 | + | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| NBY13_RS19495 (4043107) | 4043107..4043594 | + | 488 | Protein_3802 | DUF5983 family protein | - |
| NBY13_RS19500 (4043611) | 4043611..4043808 | + | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| NBY13_RS19505 (4043893) | 4043893..4044738 | + | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| NBY13_RS19510 (4044883) | 4044883..4045308 | + | 426 | WP_000422741.1 | transposase | - |
| NBY13_RS19515 (4045305) | 4045305..4045655 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NBY13_RS19520 (4045686) | 4045686..4047299 | + | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| NBY13_RS19525 (4047347) | 4047347..4047742 | + | 396 | WP_000208383.1 | DUF6088 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T247198 WP_001546109.1 NZ_CP098219:4042733-4043110 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT247198 WP_001546108.1 NZ_CP098219:4042276-4042656 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|