Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3894430..3895084 | Replicon | chromosome |
Accession | NZ_CP098219 | ||
Organism | Escherichia coli strain Z0117EC0013 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | NBY13_RS18720 | Protein ID | WP_000244765.1 |
Coordinates | 3894430..3894837 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | NBY13_RS18725 | Protein ID | WP_000354050.1 |
Coordinates | 3894818..3895084 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY13_RS18700 (3890387) | 3890387..3892120 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NBY13_RS18705 (3892126) | 3892126..3892836 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY13_RS18710 (3892861) | 3892861..3893757 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NBY13_RS18715 (3893869) | 3893869..3894390 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NBY13_RS18720 (3894430) | 3894430..3894837 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
NBY13_RS18725 (3894818) | 3894818..3895084 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
NBY13_RS18730 (3895327) | 3895327..3896307 | + | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
NBY13_RS18735 (3896384) | 3896384..3897043 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
NBY13_RS18740 (3897207) | 3897207..3897518 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY13_RS18745 (3897563) | 3897563..3898996 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T247197 WP_000244765.1 NZ_CP098219:c3894837-3894430 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |