Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1322305..1322923 | Replicon | chromosome |
| Accession | NZ_CP098219 | ||
| Organism | Escherichia coli strain Z0117EC0013 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NBY13_RS06210 | Protein ID | WP_001291435.1 |
| Coordinates | 1322305..1322523 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NBY13_RS06215 | Protein ID | WP_000344800.1 |
| Coordinates | 1322549..1322923 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY13_RS06175 (1317593) | 1317593..1318165 | + | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
| NBY13_RS06180 (1318196) | 1318196..1318507 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| NBY13_RS06190 (1318886) | 1318886..1319239 | + | 354 | WP_000878147.1 | DUF1428 family protein | - |
| NBY13_RS06195 (1319281) | 1319281..1320831 | - | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NBY13_RS06200 (1320995) | 1320995..1321465 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NBY13_RS06205 (1321581) | 1321581..1322132 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| NBY13_RS06210 (1322305) | 1322305..1322523 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NBY13_RS06215 (1322549) | 1322549..1322923 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY13_RS06220 (1323469) | 1323469..1326618 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| NBY13_RS06225 (1326641) | 1326641..1327834 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247184 WP_001291435.1 NZ_CP098219:c1322523-1322305 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247184 WP_000344800.1 NZ_CP098219:c1322923-1322549 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |