Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 907889..908439 Replicon chromosome
Accession NZ_CP098219
Organism Escherichia coli strain Z0117EC0013

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NBY13_RS04260 Protein ID WP_001160966.1
Coordinates 908125..908439 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NBY13_RS04255 Protein ID WP_000125566.1
Coordinates 907889..908122 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY13_RS04230 (902962) 902962..903249 + 288 WP_000203741.1 ferredoxin-like protein FixX -
NBY13_RS04235 (903308) 903308..904639 + 1332 WP_001183207.1 MFS transporter -
NBY13_RS04240 (904747) 904747..905277 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NBY13_RS04245 (905270) 905270..907132 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
NBY13_RS04250 (907324) 907324..907803 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
NBY13_RS04255 (907889) 907889..908122 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NBY13_RS04260 (908125) 908125..908439 + 315 WP_001160966.1 CcdB family protein Toxin
NBY13_RS04265 (908436) 908436..909284 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NBY13_RS04270 (909291) 909291..909668 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NBY13_RS04275 (909671) 909671..910492 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NBY13_RS04280 (910489) 910489..911478 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NBY13_RS04285 (911478) 911478..912764 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T247182 WP_001160966.1 NZ_CP098219:908125-908439 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT247182 WP_000125566.1 NZ_CP098219:907889-908122 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References