Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 5021618..5022453 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NBY14_RS23980 | Protein ID | WP_001565141.1 |
Coordinates | 5022076..5022453 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NBY14_RS23975 | Protein ID | WP_001565140.1 |
Coordinates | 5021618..5021986 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS23955 (5019366) | 5019366..5020184 | + | 819 | WP_021536653.1 | DUF932 domain-containing protein | - |
NBY14_RS23960 (5020276) | 5020276..5020761 | + | 486 | WP_001565139.1 | antirestriction protein | - |
NBY14_RS23965 (5020777) | 5020777..5021253 | + | 477 | WP_001186724.1 | RadC family protein | - |
NBY14_RS23970 (5021322) | 5021322..5021543 | + | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
NBY14_RS23975 (5021618) | 5021618..5021986 | + | 369 | WP_001565140.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NBY14_RS23980 (5022076) | 5022076..5022453 | + | 378 | WP_001565141.1 | TA system toxin CbtA family protein | Toxin |
NBY14_RS23985 (5022450) | 5022450..5022938 | + | 489 | WP_001565142.1 | DUF5983 family protein | - |
NBY14_RS23990 (5022950) | 5022950..5023147 | + | 198 | WP_000839256.1 | DUF957 domain-containing protein | - |
NBY14_RS23995 (5023232) | 5023232..5024074 | + | 843 | WP_001565143.1 | DUF4942 domain-containing protein | - |
NBY14_RS24000 (5024258) | 5024258..5024463 | + | 206 | Protein_4692 | RhuM family protein | - |
NBY14_RS24005 (5024868) | 5024868..5026052 | + | 1185 | WP_001172876.1 | sugar efflux transporter | - |
NBY14_RS24010 (5026163) | 5026163..5027086 | + | 924 | WP_000535949.1 | carboxylate/amino acid/amine transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14246.27 Da Isoelectric Point: 7.2920
>T247178 WP_001565141.1 NZ_CP098217:5022076-5022453 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SICPRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13604.41 Da Isoelectric Point: 6.7389
>AT247178 WP_001565140.1 NZ_CP098217:5021618-5021986 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFALLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFALLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|