Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3922302..3922885 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | NBY14_RS18625 | Protein ID | WP_000254738.1 |
Coordinates | 3922302..3922637 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NBY14_RS18630 | Protein ID | WP_000581937.1 |
Coordinates | 3922637..3922885 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS18610 (3918188) | 3918188..3919486 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
NBY14_RS18615 (3919574) | 3919574..3921211 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NBY14_RS18620 (3921439) | 3921439..3922230 | - | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NBY14_RS18625 (3922302) | 3922302..3922637 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
NBY14_RS18630 (3922637) | 3922637..3922885 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NBY14_RS18635 (3922963) | 3922963..3925197 | - | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
NBY14_RS18640 (3925245) | 3925245..3926546 | - | 1302 | WP_001551563.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T247173 WP_000254738.1 NZ_CP098217:c3922637-3922302 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|