Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2456296..2456934 | Replicon | chromosome |
| Accession | NZ_CP098217 | ||
| Organism | Escherichia coli strain Z0117EC0032 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | NBY14_RS11680 | Protein ID | WP_000813795.1 |
| Coordinates | 2456296..2456472 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NBY14_RS11685 | Protein ID | WP_076797675.1 |
| Coordinates | 2456518..2456934 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY14_RS11660 (2451918) | 2451918..2453090 | - | 1173 | WP_231531981.1 | BenE family transporter YdcO | - |
| NBY14_RS11665 (2453182) | 2453182..2453718 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| NBY14_RS11670 (2453791) | 2453791..2455752 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NBY14_RS11675 (2455844) | 2455844..2456074 | - | 231 | WP_023910283.1 | YncJ family protein | - |
| NBY14_RS11680 (2456296) | 2456296..2456472 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NBY14_RS11685 (2456518) | 2456518..2456934 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NBY14_RS11690 (2457013) | 2457013..2458419 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| NBY14_RS11695 (2458664) | 2458664..2459809 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| NBY14_RS11700 (2459827) | 2459827..2460840 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| NBY14_RS11705 (2460841) | 2460841..2461782 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T247164 WP_000813795.1 NZ_CP098217:2456296-2456472 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT247164 WP_076797675.1 NZ_CP098217:2456518-2456934 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|