Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2027014..2027798 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NBY14_RS09450 | Protein ID | WP_000613626.1 |
Coordinates | 2027014..2027508 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NBY14_RS09455 | Protein ID | WP_001110447.1 |
Coordinates | 2027505..2027798 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS09430 (2022207) | 2022207..2023304 | + | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
NBY14_RS09435 (2023304) | 2023304..2024245 | + | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NBY14_RS09440 (2024311) | 2024311..2025954 | + | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
NBY14_RS09445 (2025966) | 2025966..2026919 | + | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NBY14_RS09450 (2027014) | 2027014..2027508 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NBY14_RS09455 (2027505) | 2027505..2027798 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NBY14_RS09460 (2027931) | 2027931..2031116 | - | 3186 | WP_001550951.1 | ribonuclease E | - |
NBY14_RS09465 (2031689) | 2031689..2032648 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T247160 WP_000613626.1 NZ_CP098217:c2027508-2027014 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|