Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1772325..1773030 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NBY14_RS08245 | Protein ID | WP_000539521.1 |
Coordinates | 1772644..1773030 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NBY14_RS08240 | Protein ID | WP_001280945.1 |
Coordinates | 1772325..1772654 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS08225 (1767482) | 1767482..1768393 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
NBY14_RS08230 (1768571) | 1768571..1770919 | + | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
NBY14_RS08235 (1770927) | 1770927..1772255 | + | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
NBY14_RS08240 (1772325) | 1772325..1772654 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NBY14_RS08245 (1772644) | 1772644..1773030 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY14_RS08250 (1773256) | 1773256..1774581 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NBY14_RS08255 (1774794) | 1774794..1775177 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NBY14_RS08260 (1775288) | 1775288..1776403 | + | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
NBY14_RS08265 (1776400) | 1776400..1777026 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T247159 WP_000539521.1 NZ_CP098217:c1773030-1772644 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|