Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1362789..1363407 | Replicon | chromosome |
| Accession | NZ_CP098217 | ||
| Organism | Escherichia coli strain Z0117EC0032 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NBY14_RS06425 | Protein ID | WP_001291435.1 |
| Coordinates | 1362789..1363007 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NBY14_RS06430 | Protein ID | WP_000344800.1 |
| Coordinates | 1363033..1363407 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY14_RS06390 (1358078) | 1358078..1358650 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| NBY14_RS06395 (1358681) | 1358681..1358992 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| NBY14_RS06405 (1359371) | 1359371..1359724 | + | 354 | WP_001550741.1 | DUF1428 family protein | - |
| NBY14_RS06410 (1359766) | 1359766..1361316 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NBY14_RS06415 (1361480) | 1361480..1361950 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NBY14_RS06420 (1362066) | 1362066..1362617 | - | 552 | WP_060579167.1 | maltose O-acetyltransferase | - |
| NBY14_RS06425 (1362789) | 1362789..1363007 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NBY14_RS06430 (1363033) | 1363033..1363407 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY14_RS06435 (1363953) | 1363953..1367102 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NBY14_RS06440 (1367125) | 1367125..1368318 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247158 WP_001291435.1 NZ_CP098217:c1363007-1362789 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247158 WP_000344800.1 NZ_CP098217:c1363407-1363033 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |