Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 627669..628264 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | NBY14_RS02915 | Protein ID | WP_019842229.1 |
Coordinates | 627914..628264 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | NBY14_RS02910 | Protein ID | WP_001223213.1 |
Coordinates | 627669..627920 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS02900 (623334) | 623334..627113 | + | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
NBY14_RS02905 (627116) | 627116..627457 | + | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
NBY14_RS02910 (627669) | 627669..627920 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NBY14_RS02915 (627914) | 627914..628264 | + | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
NBY14_RS02920 (628468) | 628468..628998 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NBY14_RS02925 (629308) | 629308..630264 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NBY14_RS02930 (630396) | 630396..631898 | + | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
NBY14_RS02935 (631912) | 631912..632934 | + | 1023 | WP_001550507.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T247154 WP_019842229.1 NZ_CP098217:627914-628264 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |