Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 98315..98940 | Replicon | plasmid pZ0117EC0036-1 |
| Accession | NZ_CP098215 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NBY15_RS25150 | Protein ID | WP_000911313.1 |
| Coordinates | 98315..98713 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | NBY15_RS25155 | Protein ID | WP_000450520.1 |
| Coordinates | 98713..98940 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS25135 (94640) | 94640..95137 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
| NBY15_RS25140 (95169) | 95169..95900 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| NBY15_RS25145 (96153) | 96153..98306 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
| NBY15_RS25150 (98315) | 98315..98713 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY15_RS25155 (98713) | 98713..98940 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / sitABCD / blaTEM-1B / aac(3)-IId / blaCTX-M-65 | iucA / iucB / iucC / iucD / iutA / iroC / iroC / iroC / iroD / iroD / iroE / iroN | 1..157136 | 157136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T247148 WP_000911313.1 NZ_CP098215:c98713-98315 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|