Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4576346..4577144 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZRI1 |
| Locus tag | NBY15_RS22320 | Protein ID | WP_000854738.1 |
| Coordinates | 4576767..4577144 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A067H947 |
| Locus tag | NBY15_RS22315 | Protein ID | WP_001285415.1 |
| Coordinates | 4576346..4576720 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS22280 (4572277) | 4572277..4572957 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| NBY15_RS22285 (4573105) | 4573105..4573782 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| NBY15_RS22290 (4573788) | 4573788..4574021 | + | 234 | WP_001278290.1 | DUF905 family protein | - |
| NBY15_RS22295 (4574111) | 4574111..4574929 | + | 819 | WP_021573129.1 | DUF932 domain-containing protein | - |
| NBY15_RS22300 (4575011) | 4575011..4575490 | + | 480 | WP_000844100.1 | antirestriction protein | - |
| NBY15_RS22305 (4575506) | 4575506..4575982 | + | 477 | WP_021511973.1 | RadC family protein | - |
| NBY15_RS22310 (4576045) | 4576045..4576266 | + | 222 | WP_000692309.1 | DUF987 domain-containing protein | - |
| NBY15_RS22315 (4576346) | 4576346..4576720 | + | 375 | WP_001285415.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY15_RS22320 (4576767) | 4576767..4577144 | + | 378 | WP_000854738.1 | TA system toxin CbtA family protein | Toxin |
| NBY15_RS22325 (4577141) | 4577141..4577629 | + | 489 | WP_000761688.1 | DUF5983 family protein | - |
| NBY15_RS22330 (4577647) | 4577647..4577844 | + | 198 | WP_000839268.1 | DUF957 domain-containing protein | - |
| NBY15_RS22335 (4577941) | 4577941..4578510 | + | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| NBY15_RS22340 (4579259) | 4579259..4580797 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4557181..4588610 | 31429 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14089.12 Da Isoelectric Point: 8.2904
>T247142 WP_000854738.1 NZ_CP098214:4576767-4577144 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13663.32 Da Isoelectric Point: 5.8640
>AT247142 WP_001285415.1 NZ_CP098214:4576346-4576720 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A7ZRI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067H947 |