Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2999663..3000464 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | NBY15_RS14905 | Protein ID | WP_000854739.1 |
| Coordinates | 2999663..3000043 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NBY15_RS14910 | Protein ID | WP_021560693.1 |
| Coordinates | 3000090..3000464 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS14870 (2995254) | 2995254..2995808 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| NBY15_RS14875 (2995832) | 2995832..2996569 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| NBY15_RS14880 (2996624) | 2996624..2997562 | - | 939 | WP_021520639.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| NBY15_RS14890 (2998033) | 2998033..2998876 | - | 844 | Protein_2927 | DUF4942 domain-containing protein | - |
| NBY15_RS14895 (2998961) | 2998961..2999158 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| NBY15_RS14900 (2999178) | 2999178..2999666 | - | 489 | WP_001054232.1 | DUF5983 family protein | - |
| NBY15_RS14905 (2999663) | 2999663..3000043 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| NBY15_RS14910 (3000090) | 3000090..3000464 | - | 375 | WP_021560693.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY15_RS14915 (3000514) | 3000514..3001158 | - | 645 | WP_021560694.1 | hypothetical protein | - |
| NBY15_RS14920 (3001177) | 3001177..3001398 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| NBY15_RS14925 (3001461) | 3001461..3001937 | - | 477 | WP_001186170.1 | RadC family protein | - |
| NBY15_RS14930 (3001953) | 3001953..3002426 | - | 474 | WP_001542276.1 | antirestriction protein | - |
| NBY15_RS14935 (3002520) | 3002520..3002765 | - | 246 | WP_001164966.1 | hypothetical protein | - |
| NBY15_RS14940 (3002765) | 3002765..3003586 | - | 822 | WP_021560695.1 | DUF932 domain-containing protein | - |
| NBY15_RS14945 (3003765) | 3003765..3003854 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| NBY15_RS14950 (3003997) | 3003997..3004452 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T247132 WP_000854739.1 NZ_CP098214:c3000043-2999663 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13863.51 Da Isoelectric Point: 4.5940
>AT247132 WP_021560693.1 NZ_CP098214:c3000464-3000090 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWELPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWELPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|