Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1312726..1313384 | Replicon | chromosome |
Accession | NZ_CP098214 | ||
Organism | Escherichia coli strain Z0117EC0036 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | NBY15_RS06545 | Protein ID | WP_021520983.1 |
Coordinates | 1312726..1313046 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NBY15_RS06550 | Protein ID | WP_021520982.1 |
Coordinates | 1313067..1313384 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY15_RS06530 (1308148) | 1308148..1309596 | - | 1449 | WP_220401795.1 | NADP-dependent succinate-semialdehyde dehydrogenase | - |
NBY15_RS06535 (1309619) | 1309619..1310887 | - | 1269 | WP_000271981.1 | L-2-hydroxyglutarate oxidase | - |
NBY15_RS06540 (1310907) | 1310907..1311884 | - | 978 | WP_220401794.1 | glutarate dioxygenase GlaH | - |
NBY15_RS06545 (1312726) | 1312726..1313046 | - | 321 | WP_021520983.1 | TA system toxin CbtA family protein | Toxin |
NBY15_RS06550 (1313067) | 1313067..1313384 | - | 318 | WP_021520982.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NBY15_RS06555 (1313403) | 1313403..1313624 | - | 222 | WP_021520981.1 | DUF987 domain-containing protein | - |
NBY15_RS06560 (1313633) | 1313633..1314109 | - | 477 | WP_021520980.1 | RadC family protein | - |
NBY15_RS06565 (1314125) | 1314125..1314583 | - | 459 | WP_021520979.1 | antirestriction protein | - |
NBY15_RS06570 (1314679) | 1314679..1314918 | - | 240 | WP_021520978.1 | DUF905 domain-containing protein | - |
NBY15_RS06575 (1315018) | 1315018..1315926 | - | 909 | WP_021520977.1 | Ivy family c-type lysozyme inhibitor | - |
NBY15_RS06580 (1315995) | 1315995..1316162 | - | 168 | Protein_1294 | DUF4339 domain-containing protein | - |
NBY15_RS06585 (1316200) | 1316200..1316895 | - | 696 | WP_021520976.1 | hypothetical protein | - |
NBY15_RS06590 (1317122) | 1317122..1317949 | - | 828 | WP_021520975.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12162.18 Da Isoelectric Point: 7.1656
>T247125 WP_021520983.1 NZ_CP098214:c1313046-1312726 [Escherichia coli]
MKTLPATTLWAAKPCLSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
MKTLPATTLWAAKPCLSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|