Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1192401..1192984 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | V0SV58 |
| Locus tag | NBY15_RS05920 | Protein ID | WP_000254750.1 |
| Coordinates | 1192649..1192984 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NBY15_RS05915 | Protein ID | WP_000581937.1 |
| Coordinates | 1192401..1192649 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS05905 (1188740) | 1188740..1190041 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NBY15_RS05910 (1190089) | 1190089..1192323 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NBY15_RS05915 (1192401) | 1192401..1192649 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NBY15_RS05920 (1192649) | 1192649..1192984 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
| NBY15_RS05925 (1193056) | 1193056..1193847 | + | 792 | WP_001071677.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NBY15_RS05930 (1194075) | 1194075..1195712 | + | 1638 | WP_000210888.1 | CTP synthase (glutamine hydrolyzing) | - |
| NBY15_RS05935 (1195800) | 1195800..1197098 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T247124 WP_000254750.1 NZ_CP098214:1192649-1192984 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|