Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1039895..1040549 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NBY15_RS05305 | Protein ID | WP_000244781.1 |
| Coordinates | 1040142..1040549 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NBY15_RS05300 | Protein ID | WP_000354046.1 |
| Coordinates | 1039895..1040161 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS05280 (1035983) | 1035983..1037416 | - | 1434 | Protein_1043 | 6-phospho-beta-glucosidase BglA | - |
| NBY15_RS05285 (1037461) | 1037461..1037772 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY15_RS05290 (1037936) | 1037936..1038595 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NBY15_RS05295 (1038672) | 1038672..1039652 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| NBY15_RS05300 (1039895) | 1039895..1040161 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NBY15_RS05305 (1040142) | 1040142..1040549 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NBY15_RS05310 (1040589) | 1040589..1041110 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NBY15_RS05315 (1041222) | 1041222..1042118 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NBY15_RS05320 (1042143) | 1042143..1042853 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY15_RS05325 (1042859) | 1042859..1044592 | + | 1734 | WP_021521009.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T247123 WP_000244781.1 NZ_CP098214:1040142-1040549 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|