Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 87529..88327 | Replicon | chromosome |
| Accession | NZ_CP098214 | ||
| Organism | Escherichia coli strain Z0117EC0036 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NBY15_RS00440 | Protein ID | WP_019841259.1 |
| Coordinates | 87529..87906 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NBY15_RS00445 | Protein ID | WP_019841258.1 |
| Coordinates | 87953..88327 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY15_RS00410 (82892) | 82892..83710 | + | 819 | WP_000779409.1 | lipoprotein NlpA | - |
| NBY15_RS00415 (83714) | 83714..84637 | - | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| NBY15_RS00420 (84804) | 84804..85301 | - | 498 | WP_000509811.1 | hypothetical protein | - |
| NBY15_RS00425 (85894) | 85894..86739 | - | 846 | WP_019841260.1 | DUF4942 domain-containing protein | - |
| NBY15_RS00430 (86835) | 86835..87032 | - | 198 | WP_001609487.1 | DUF957 domain-containing protein | - |
| NBY15_RS00435 (87044) | 87044..87532 | - | 489 | WP_001609486.1 | DUF5983 family protein | - |
| NBY15_RS00440 (87529) | 87529..87906 | - | 378 | WP_019841259.1 | TA system toxin CbtA family protein | Toxin |
| NBY15_RS00445 (87953) | 87953..88327 | - | 375 | WP_019841258.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY15_RS00450 (88377) | 88377..89021 | - | 645 | WP_001609482.1 | hypothetical protein | - |
| NBY15_RS00455 (89040) | 89040..89261 | - | 222 | WP_019841257.1 | DUF987 domain-containing protein | - |
| NBY15_RS00460 (89330) | 89330..89806 | - | 477 | WP_001186725.1 | RadC family protein | - |
| NBY15_RS00465 (89822) | 89822..90301 | - | 480 | WP_019841256.1 | antirestriction protein | - |
| NBY15_RS00470 (90383) | 90383..91201 | - | 819 | WP_019841255.1 | DUF932 domain-containing protein | - |
| NBY15_RS00475 (91291) | 91291..91524 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| NBY15_RS00480 (91530) | 91530..92207 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| NBY15_RS00485 (92355) | 92355..93035 | - | 681 | WP_042197347.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14151.12 Da Isoelectric Point: 7.1881
>T247120 WP_019841259.1 NZ_CP098214:c87906-87529 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKYPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKYPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13683.52 Da Isoelectric Point: 6.0568
>AT247120 WP_019841258.1 NZ_CP098214:c88327-87953 [Escherichia coli]
VSDTLPGTTLPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|