Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 4233639..4234166 Replicon chromosome
Accession NZ_CP098211
Organism Escherichia coli strain Z0117EC0040

Toxin (Protein)


Gene name relE Uniprot ID A0A7H9NEL1
Locus tag NBY16_RS20400 Protein ID WP_023220446.1
Coordinates 4233639..4233914 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7H9NIT7
Locus tag NBY16_RS20405 Protein ID WP_023220445.1
Coordinates 4233918..4234166 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY16_RS20390 (4229255) 4229255..4232371 + 3117 WP_048963609.1 HsdR family type I site-specific deoxyribonuclease -
NBY16_RS20395 (4232727) 4232727..4233509 - 783 WP_244470603.1 helix-turn-helix transcriptional regulator -
NBY16_RS20400 (4233639) 4233639..4233914 - 276 WP_023220446.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY16_RS20405 (4233918) 4233918..4234166 - 249 WP_023220445.1 ribbon-helix-helix domain-containing protein Antitoxin
NBY16_RS20410 (4234242) 4234242..4235084 - 843 WP_048963608.1 DUF4942 domain-containing protein -
NBY16_RS20415 (4235197) 4235197..4235547 - 351 WP_053087800.1 DUF5983 family protein -
NBY16_RS20420 (4235574) 4235574..4235750 - 177 Protein_4008 DUF5983 family protein -
NBY16_RS20425 (4235741) 4235741..4236115 - 375 WP_023220442.1 TA system toxin CbtA family protein -
NBY16_RS20430 (4236161) 4236161..4236808 - 648 WP_048963607.1 hypothetical protein -
NBY16_RS20435 (4236805) 4236805..4237176 - 372 WP_048963606.1 type IV toxin-antitoxin system YeeU family antitoxin -
NBY16_RS20440 (4237148) 4237148..4237516 - 369 WP_023220439.1 type IV toxin-antitoxin system YeeU family antitoxin -
NBY16_RS20445 (4237534) 4237534..4237755 - 222 WP_048963605.1 DUF987 family protein -
NBY16_RS20450 (4237752) 4237752..4238042 - 291 WP_048963604.1 hypothetical protein -
NBY16_RS20455 (4238058) 4238058..4238537 - 480 WP_048963603.1 DNA repair protein RadC -
NBY16_RS20460 (4238548) 4238548..4239024 - 477 WP_048963602.1 antirestriction protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB 4217609..4257518 39909


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-40)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11046.41 Da        Isoelectric Point: 5.8988

>T247112 WP_023220446.1 NZ_CP098211:c4233914-4233639 [Escherichia coli]
MEIYWTFKAQDDLERIYRFALQYSRKHADDILDRLITGCAGLTAHPAIGVHQTRYEPREVRKVLFDDYEVHYEIRDNDIH
IVDLWHTKEER

Download         Length: 276 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9004.37 Da        Isoelectric Point: 7.1666

>AT247112 WP_023220445.1 NZ_CP098211:c4234166-4233918 [Escherichia coli]
MGSLTKQTISAQIPVELAAAVENLAIELDRSKSWIIKEALTCMLAERERRHQSIQAGLADVDAGRVVSHSDMVDFANRLK
KA

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9NEL1

Antitoxin

Source ID Structure
AlphaFold DB A0A7H9NIT7

References