Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3591814..3592651 | Replicon | chromosome |
Accession | NZ_CP098211 | ||
Organism | Escherichia coli strain Z0117EC0040 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NBY16_RS17325 | Protein ID | WP_000227784.1 |
Coordinates | 3592109..3592651 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NBY16_RS17320 | Protein ID | WP_001297137.1 |
Coordinates | 3591814..3592125 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY16_RS17295 (3586834) | 3586834..3587781 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NBY16_RS17300 (3587803) | 3587803..3589794 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NBY16_RS17305 (3589784) | 3589784..3590398 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NBY16_RS17310 (3590398) | 3590398..3590727 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NBY16_RS17315 (3590739) | 3590739..3591629 | + | 891 | WP_000971336.1 | heme o synthase | - |
NBY16_RS17320 (3591814) | 3591814..3592125 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NBY16_RS17325 (3592109) | 3592109..3592651 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NBY16_RS17330 (3592707) | 3592707..3593642 | - | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
NBY16_RS17335 (3594050) | 3594050..3595414 | + | 1365 | WP_001000960.1 | MFS transporter | - |
NBY16_RS17340 (3595542) | 3595542..3596033 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NBY16_RS17345 (3596201) | 3596201..3597112 | + | 912 | WP_000705865.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T247109 WP_000227784.1 NZ_CP098211:3592109-3592651 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|