Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3557736..3558354 | Replicon | chromosome |
Accession | NZ_CP098211 | ||
Organism | Escherichia coli strain Z0117EC0040 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NBY16_RS17155 | Protein ID | WP_001291435.1 |
Coordinates | 3558136..3558354 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NBY16_RS17150 | Protein ID | WP_000344800.1 |
Coordinates | 3557736..3558110 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY16_RS17140 (3552825) | 3552825..3554018 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NBY16_RS17145 (3554041) | 3554041..3557190 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NBY16_RS17150 (3557736) | 3557736..3558110 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NBY16_RS17155 (3558136) | 3558136..3558354 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NBY16_RS17160 (3558526) | 3558526..3559077 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NBY16_RS17165 (3559193) | 3559193..3559663 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NBY16_RS17170 (3559827) | 3559827..3561376 | + | 1550 | Protein_3369 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NBY16_RS17175 (3561418) | 3561418..3561771 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
NBY16_RS17185 (3562150) | 3562150..3562461 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NBY16_RS17190 (3562492) | 3562492..3563064 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247108 WP_001291435.1 NZ_CP098211:3558136-3558354 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247108 WP_000344800.1 NZ_CP098211:3557736-3558110 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |