Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2529785..2530423 | Replicon | chromosome |
| Accession | NZ_CP098211 | ||
| Organism | Escherichia coli strain Z0117EC0040 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NBY16_RS12210 | Protein ID | WP_000813794.1 |
| Coordinates | 2530247..2530423 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NBY16_RS12205 | Protein ID | WP_001270285.1 |
| Coordinates | 2529785..2530201 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY16_RS12185 (2524937) | 2524937..2525878 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NBY16_RS12190 (2525879) | 2525879..2526892 | - | 1014 | WP_000220412.1 | ABC transporter ATP-binding protein | - |
| NBY16_RS12195 (2526910) | 2526910..2528055 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NBY16_RS12200 (2528300) | 2528300..2529706 | - | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
| NBY16_RS12205 (2529785) | 2529785..2530201 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NBY16_RS12210 (2530247) | 2530247..2530423 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NBY16_RS12215 (2530645) | 2530645..2530875 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NBY16_RS12220 (2530967) | 2530967..2532928 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NBY16_RS12225 (2533001) | 2533001..2533537 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NBY16_RS12230 (2533590) | 2533590..2534804 | + | 1215 | WP_001307190.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2534844..2536109 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T247107 WP_000813794.1 NZ_CP098211:c2530423-2530247 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT247107 WP_001270285.1 NZ_CP098211:c2530201-2529785 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|