Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1374489..1375114 | Replicon | chromosome |
Accession | NZ_CP098211 | ||
Organism | Escherichia coli strain Z0117EC0040 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | NBY16_RS06615 | Protein ID | WP_000911329.1 |
Coordinates | 1374716..1375114 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NBY16_RS06610 | Protein ID | WP_000450524.1 |
Coordinates | 1374489..1374716 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY16_RS06585 (1370291) | 1370291..1370761 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NBY16_RS06590 (1370761) | 1370761..1371333 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NBY16_RS06595 (1371479) | 1371479..1372357 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NBY16_RS06600 (1372374) | 1372374..1373408 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NBY16_RS06605 (1373621) | 1373621..1374334 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NBY16_RS06610 (1374489) | 1374489..1374716 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NBY16_RS06615 (1374716) | 1374716..1375114 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY16_RS06620 (1375261) | 1375261..1376124 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NBY16_RS06625 (1376139) | 1376139..1378154 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NBY16_RS06630 (1378228) | 1378228..1378926 | + | 699 | WP_000679823.1 | esterase | - |
NBY16_RS06635 (1379007) | 1379007..1379207 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T247100 WP_000911329.1 NZ_CP098211:1374716-1375114 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |