Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 943588..944242 | Replicon | chromosome |
Accession | NZ_CP098211 | ||
Organism | Escherichia coli strain Z0117EC0040 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | NBY16_RS04570 | Protein ID | WP_000244772.1 |
Coordinates | 943835..944242 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NBY16_RS04565 | Protein ID | WP_000354046.1 |
Coordinates | 943588..943854 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY16_RS04540 (938757) | 938757..939500 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
NBY16_RS04545 (939557) | 939557..940990 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
NBY16_RS04550 (941035) | 941035..941346 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY16_RS04555 (941510) | 941510..942169 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NBY16_RS04560 (942365) | 942365..943345 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NBY16_RS04565 (943588) | 943588..943854 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NBY16_RS04570 (943835) | 943835..944242 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
NBY16_RS04575 (944282) | 944282..944803 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NBY16_RS04580 (944915) | 944915..945811 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NBY16_RS04585 (945836) | 945836..946546 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY16_RS04590 (946552) | 946552..948285 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T247098 WP_000244772.1 NZ_CP098211:943835-944242 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |