Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3723797..3724415 | Replicon | chromosome |
| Accession | NZ_CP098210 | ||
| Organism | Escherichia coli strain Z0117EC0051 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NBY17_RS17635 | Protein ID | WP_001291435.1 |
| Coordinates | 3724197..3724415 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NBY17_RS17630 | Protein ID | WP_000344800.1 |
| Coordinates | 3723797..3724171 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY17_RS17620 (3718886) | 3718886..3720079 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NBY17_RS17625 (3720102) | 3720102..3723251 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NBY17_RS17630 (3723797) | 3723797..3724171 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY17_RS17635 (3724197) | 3724197..3724415 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NBY17_RS17640 (3724587) | 3724587..3725138 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NBY17_RS17645 (3725254) | 3725254..3725724 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NBY17_RS17650 (3725888) | 3725888..3727438 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NBY17_RS17655 (3727480) | 3727480..3727833 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
| NBY17_RS17665 (3728212) | 3728212..3728523 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NBY17_RS17670 (3728554) | 3728554..3729126 | - | 573 | WP_086773737.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247091 WP_001291435.1 NZ_CP098210:3724197-3724415 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247091 WP_000344800.1 NZ_CP098210:3723797-3724171 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |