Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3321260..3321965 | Replicon | chromosome |
| Accession | NZ_CP098210 | ||
| Organism | Escherichia coli strain Z0117EC0051 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NBY17_RS15860 | Protein ID | WP_000539521.1 |
| Coordinates | 3321260..3321646 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NBY17_RS15865 | Protein ID | WP_001280945.1 |
| Coordinates | 3321636..3321965 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY17_RS15840 (3317264) | 3317264..3317890 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| NBY17_RS15845 (3317887) | 3317887..3319002 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
| NBY17_RS15850 (3319113) | 3319113..3319496 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NBY17_RS15855 (3319709) | 3319709..3321034 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NBY17_RS15860 (3321260) | 3321260..3321646 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY17_RS15865 (3321636) | 3321636..3321965 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NBY17_RS15870 (3322035) | 3322035..3323363 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
| NBY17_RS15875 (3323371) | 3323371..3325719 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
| NBY17_RS15880 (3325897) | 3325897..3326808 | - | 912 | Protein_3116 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T247090 WP_000539521.1 NZ_CP098210:3321260-3321646 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|