Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 916983..917818 Replicon chromosome
Accession NZ_CP098210
Organism Escherichia coli strain Z0117EC0051

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag NBY17_RS04260 Protein ID WP_001564063.1
Coordinates 916983..917360 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag NBY17_RS04265 Protein ID WP_038432125.1
Coordinates 917450..917818 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY17_RS04230 (912111) 912111..913259 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
NBY17_RS04235 (913331) 913331..914314 - 984 WP_001361242.1 KpsF/GutQ family sugar-phosphate isomerase -
NBY17_RS04240 (915125) 915125..915295 - 171 Protein_824 IS110 family transposase -
NBY17_RS04245 (915637) 915637..916479 - 843 Protein_825 DUF4942 domain-containing protein -
NBY17_RS04250 (916564) 916564..916758 - 195 WP_024181941.1 DUF957 domain-containing protein -
NBY17_RS04255 (916837) 916837..916986 - 150 Protein_827 DUF5983 family protein -
NBY17_RS04260 (916983) 916983..917360 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
NBY17_RS04265 (917450) 917450..917818 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY17_RS04270 (917981) 917981..918202 - 222 WP_000692345.1 DUF987 domain-containing protein -
NBY17_RS04275 (918267) 918267..918743 - 477 WP_021553055.1 RadC family protein -
NBY17_RS04280 (918759) 918759..919238 - 480 WP_001564060.1 antirestriction protein -
NBY17_RS04285 (919504) 919504..920322 - 819 WP_001175165.1 DUF932 domain-containing protein -
NBY17_RS04290 (920412) 920412..920645 - 234 WP_001278293.1 DUF905 family protein -
NBY17_RS04295 (920651) 920651..921328 - 678 WP_001564058.1 hypothetical protein -
NBY17_RS04300 (921479) 921479..922159 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 915510..983221 67711
- flank IS/Tn - - 915125..915229 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T247079 WP_001564063.1 NZ_CP098210:c917360-916983 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT247079 WP_038432125.1 NZ_CP098210:c917818-917450 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References