Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 916983..917818 | Replicon | chromosome |
| Accession | NZ_CP098210 | ||
| Organism | Escherichia coli strain Z0117EC0051 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | NBY17_RS04260 | Protein ID | WP_001564063.1 |
| Coordinates | 916983..917360 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0A1AEL8 |
| Locus tag | NBY17_RS04265 | Protein ID | WP_038432125.1 |
| Coordinates | 917450..917818 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY17_RS04230 (912111) | 912111..913259 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| NBY17_RS04235 (913331) | 913331..914314 | - | 984 | WP_001361242.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NBY17_RS04240 (915125) | 915125..915295 | - | 171 | Protein_824 | IS110 family transposase | - |
| NBY17_RS04245 (915637) | 915637..916479 | - | 843 | Protein_825 | DUF4942 domain-containing protein | - |
| NBY17_RS04250 (916564) | 916564..916758 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| NBY17_RS04255 (916837) | 916837..916986 | - | 150 | Protein_827 | DUF5983 family protein | - |
| NBY17_RS04260 (916983) | 916983..917360 | - | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| NBY17_RS04265 (917450) | 917450..917818 | - | 369 | WP_038432125.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY17_RS04270 (917981) | 917981..918202 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NBY17_RS04275 (918267) | 918267..918743 | - | 477 | WP_021553055.1 | RadC family protein | - |
| NBY17_RS04280 (918759) | 918759..919238 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| NBY17_RS04285 (919504) | 919504..920322 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| NBY17_RS04290 (920412) | 920412..920645 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| NBY17_RS04295 (920651) | 920651..921328 | - | 678 | WP_001564058.1 | hypothetical protein | - |
| NBY17_RS04300 (921479) | 921479..922159 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 915510..983221 | 67711 | |
| - | flank | IS/Tn | - | - | 915125..915229 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T247079 WP_001564063.1 NZ_CP098210:c917360-916983 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13569.31 Da Isoelectric Point: 7.0369
>AT247079 WP_038432125.1 NZ_CP098210:c917818-917450 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AEL8 |