247074

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 54888..55435 Replicon plasmid pZ0117ECO054-2
Accession NZ_CP098208
Organism Escherichia coli strain Z0117EC0054

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag NBY18_RS25965 Protein ID WP_001384452.1
Coordinates 54888..55166 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag NBY18_RS25970 Protein ID WP_000079941.1
Coordinates 55166..55435 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY18_RS25935 (50318) 50318..50578 + 261 WP_000343091.1 hypothetical protein -
NBY18_RS25940 (50575) 50575..51165 + 591 WP_001350923.1 hypothetical protein -
NBY18_RS25945 (51227) 51227..51442 - 216 Protein_49 DUF6404 family protein -
NBY18_RS25950 (51571) 51571..51906 + 336 WP_001080729.1 colicin 1A immunity protein -
NBY18_RS25955 (51928) 51928..53808 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
NBY18_RS25960 (53994) 53994..54842 - 849 WP_001057989.1 3'-5' exonuclease -
NBY18_RS25965 (54888) 54888..55166 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
NBY18_RS25970 (55166) 55166..55435 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NBY18_RS25975 (56351) 56351..57208 - 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
NBY18_RS25980 (57201) 57201..57248 - 48 WP_077822033.1 hypothetical protein -
NBY18_RS25985 (57239) 57239..57475 + 237 WP_223368648.1 replication protein RepA -
NBY18_RS25990 (57501) 57501..57761 - 261 WP_000083818.1 replication regulatory protein RepA -
NBY18_RS25995 (57851) 57851..58207 - 357 Protein_59 thermonuclease family protein -
NBY18_RS26000 (58450) 58450..58662 - 213 WP_001311693.1 hypothetical protein -
NBY18_RS26005 (58800) 58800..59360 - 561 WP_000139359.1 fertility inhibition protein FinO -
NBY18_RS26010 (59415) 59415..60161 - 747 WP_000205759.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..131380 131380


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T247074 WP_001384452.1 NZ_CP098208:c55166-54888 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT247074 WP_000079941.1 NZ_CP098208:c55435-55166 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References