Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4551943..4552777 | Replicon | chromosome |
| Accession | NZ_CP098206 | ||
| Organism | Escherichia coli strain Z0117EC0054 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7MK10 |
| Locus tag | NBY18_RS22340 | Protein ID | WP_000854820.1 |
| Coordinates | 4552400..4552777 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | NBY18_RS22335 | Protein ID | WP_001285610.1 |
| Coordinates | 4551943..4552311 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY18_RS22300 (4547664) | 4547664..4548344 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| NBY18_RS22305 (4548495) | 4548495..4549172 | + | 678 | WP_001097565.1 | hypothetical protein | - |
| NBY18_RS22310 (4549178) | 4549178..4549411 | + | 234 | WP_000883181.1 | DUF905 family protein | - |
| NBY18_RS22315 (4549501) | 4549501..4550319 | + | 819 | WP_001175155.1 | DUF932 domain-containing protein | - |
| NBY18_RS22320 (4550585) | 4550585..4551064 | + | 480 | WP_000706978.1 | antirestriction protein | - |
| NBY18_RS22325 (4551079) | 4551079..4551555 | + | 477 | WP_001186193.1 | RadC family protein | - |
| NBY18_RS22330 (4551642) | 4551642..4551863 | + | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| NBY18_RS22335 (4551943) | 4551943..4552311 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY18_RS22340 (4552400) | 4552400..4552777 | + | 378 | WP_000854820.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NBY18_RS22345 (4552774) | 4552774..4552971 | + | 198 | Protein_4382 | DUF5983 family protein | - |
| NBY18_RS22350 (4552999) | 4552999..4553196 | + | 198 | WP_085949158.1 | DUF957 domain-containing protein | - |
| NBY18_RS22355 (4553281) | 4553281..4553841 | + | 561 | Protein_4384 | DUF4942 domain-containing protein | - |
| NBY18_RS22360 (4554676) | 4554676..4556214 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | papX | 4492355..4564027 | 71672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14043.12 Da Isoelectric Point: 7.8839
>T247070 WP_000854820.1 NZ_CP098206:4552400-4552777 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT247070 WP_001285610.1 NZ_CP098206:4551943-4552311 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|