Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3685327..3685945 | Replicon | chromosome |
Accession | NZ_CP098206 | ||
Organism | Escherichia coli strain Z0117EC0054 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NBY18_RS18130 | Protein ID | WP_001291435.1 |
Coordinates | 3685727..3685945 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NBY18_RS18125 | Protein ID | WP_000344800.1 |
Coordinates | 3685327..3685701 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY18_RS18115 (3680417) | 3680417..3681610 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NBY18_RS18120 (3681633) | 3681633..3684782 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NBY18_RS18125 (3685327) | 3685327..3685701 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NBY18_RS18130 (3685727) | 3685727..3685945 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NBY18_RS18135 (3686119) | 3686119..3686670 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
NBY18_RS18140 (3686786) | 3686786..3687256 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NBY18_RS18145 (3687420) | 3687420..3688970 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NBY18_RS18150 (3689012) | 3689012..3689365 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NBY18_RS18160 (3689744) | 3689744..3690055 | + | 312 | WP_000409908.1 | MGMT family protein | - |
NBY18_RS18165 (3690086) | 3690086..3690658 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247066 WP_001291435.1 NZ_CP098206:3685727-3685945 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247066 WP_000344800.1 NZ_CP098206:3685327-3685701 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |