247054

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 873358..874159 Replicon chromosome
Accession NZ_CP098206
Organism Escherichia coli strain Z0117EC0054

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag NBY18_RS04235 Protein ID WP_001094436.1
Coordinates 873358..873735 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag NBY18_RS04240 Protein ID WP_015953067.1
Coordinates 873782..874159 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY18_RS04210 (869561) 869561..869731 - 171 Protein_829 IS110 family transposase -
NBY18_RS04215 (870128) 870128..871663 - 1536 WP_000492897.1 EAL domain-containing protein -
NBY18_RS04220 (871734) 871734..872579 - 846 WP_001280513.1 DUF4942 domain-containing protein -
NBY18_RS04225 (872664) 872664..872861 - 198 WP_000839254.1 DUF957 domain-containing protein -
NBY18_RS04230 (872873) 872873..873361 - 489 WP_000761714.1 DUF5983 family protein -
NBY18_RS04235 (873358) 873358..873735 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
NBY18_RS04240 (873782) 873782..874159 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NBY18_RS04245 (874238) 874238..874459 - 222 WP_000692312.1 DUF987 domain-containing protein -
NBY18_RS04250 (874528) 874528..875004 - 477 WP_001186782.1 RadC family protein -
NBY18_RS04255 (875019) 875019..875504 - 486 WP_000860054.1 antirestriction protein -
NBY18_RS04260 (875595) 875595..876413 - 819 WP_001175142.1 DUF932 domain-containing protein -
NBY18_RS04265 (876503) 876503..876736 - 234 WP_001278287.1 DUF905 family protein -
NBY18_RS04270 (876742) 876742..877419 - 678 WP_001097312.1 hypothetical protein -
NBY18_RS04275 (877567) 877567..878247 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 732558..922306 189748
- flank IS/Tn - - 869561..869665 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T247054 WP_001094436.1 NZ_CP098206:c873735-873358 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT247054 WP_015953067.1 NZ_CP098206:c874159-873782 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References