Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 39900..40393 Replicon plasmid pZ0117ECO055-2
Accession NZ_CP098205
Organism Escherichia coli strain Z0117EC0055

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NBY19_RS24895 Protein ID WP_001230709.1
Coordinates 39900..40154 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NBY19_RS24900 Protein ID WP_000151456.1
Coordinates 40151..40393 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY19_RS24845 35120..35281 + 162 WP_001128311.1 hypothetical protein -
NBY19_RS24850 (NBY19_24815) 35417..35569 + 153 Protein_42 DUF5431 family protein -
NBY19_RS24855 (NBY19_24820) 35514..35636 + 123 WP_223202818.1 Hok/Gef family protein -
NBY19_RS24860 (NBY19_24825) 35785..36381 + 597 WP_000125165.1 ProQ/FINO family protein -
NBY19_RS24865 (NBY19_24830) 36399..36683 - 285 WP_001162371.1 hypothetical protein -
NBY19_RS24870 (NBY19_24835) 36757..37422 - 666 WP_015387337.1 division plane positioning ATPase MipZ -
NBY19_RS24875 37644..37877 + 234 WP_015387338.1 hypothetical protein -
NBY19_RS24880 (NBY19_24840) 38009..38338 + 330 WP_000855119.1 hypothetical protein -
NBY19_RS24885 (NBY19_24845) 38742..39257 + 516 WP_001025393.1 J domain-containing protein -
NBY19_RS24890 (NBY19_24850) 39361..39903 + 543 WP_001083904.1 hypothetical protein -
NBY19_RS24895 (NBY19_24855) 39900..40154 + 255 WP_001230709.1 hypothetical protein Toxin
NBY19_RS24900 (NBY19_24860) 40151..40393 + 243 WP_000151456.1 hypothetical protein Antitoxin
NBY19_RS24905 (NBY19_24865) 40518..40862 + 345 Protein_53 WbuC family cupin fold metalloprotein -
NBY19_RS24910 (NBY19_24870) 40909..41784 - 876 WP_000239590.1 extended-spectrum class A beta-lactamase CTX-M-15 -
NBY19_RS24915 (NBY19_24875) 42037..43299 - 1263 WP_250844078.1 IS1380-like element ISEcp1 family transposase -
NBY19_RS24920 (NBY19_24880) 43684..43917 + 234 WP_000553847.1 hypothetical protein -
NBY19_RS24925 (NBY19_24885) 44049..44336 + 288 WP_000673430.1 hypothetical protein -
NBY19_RS24930 (NBY19_24890) 44388..44762 + 375 WP_015387341.1 hypothetical protein -
NBY19_RS24935 (NBY19_24895) 44777..45070 + 294 WP_000954637.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-15 - 1..62190 62190
- flank IS/Tn blaCTX-M-15 - 40909..43299 2390


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T247053 WP_001230709.1 NZ_CP098205:39900-40154 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT247053 WP_000151456.1 NZ_CP098205:40151-40393 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References