Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4246637..4247471 | Replicon | chromosome |
| Accession | NZ_CP098203 | ||
| Organism | Escherichia coli strain Z0117EC0055 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | NBY19_RS20895 | Protein ID | WP_000854770.1 |
| Coordinates | 4246637..4247014 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | NBY19_RS20900 | Protein ID | WP_001280950.1 |
| Coordinates | 4247103..4247471 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY19_RS20870 (4242748) | 4242748..4244370 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| NBY19_RS25110 (4245032) | 4245032..4245337 | - | 306 | Protein_4096 | helix-turn-helix domain-containing protein | - |
| NBY19_RS20880 (4245704) | 4245704..4245853 | - | 150 | Protein_4097 | hypothetical protein | - |
| NBY19_RS20885 (4245959) | 4245959..4246135 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| NBY19_RS20890 (4246152) | 4246152..4246640 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| NBY19_RS20895 (4246637) | 4246637..4247014 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| NBY19_RS20900 (4247103) | 4247103..4247471 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY19_RS20905 (4247634) | 4247634..4247855 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| NBY19_RS20910 (4247918) | 4247918..4248394 | - | 477 | WP_001186779.1 | RadC family protein | - |
| NBY19_RS20915 (4248410) | 4248410..4248874 | - | 465 | WP_250844058.1 | antirestriction protein | - |
| NBY19_RS20920 (4249216) | 4249216..4250034 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| NBY19_RS20925 (4250152) | 4250152..4250347 | - | 196 | Protein_4106 | DUF905 family protein | - |
| NBY19_RS20930 (4250418) | 4250418..4252319 | - | 1902 | Protein_4107 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4234991..4275200 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T247046 WP_000854770.1 NZ_CP098203:c4247014-4246637 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT247046 WP_001280950.1 NZ_CP098203:c4247471-4247103 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |