Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4066070..4066620 Replicon chromosome
Accession NZ_CP098203
Organism Escherichia coli strain Z0117EC0055

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NBY19_RS19985 Protein ID WP_001160966.1
Coordinates 4066070..4066384 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NBY19_RS19990 Protein ID WP_000125566.1
Coordinates 4066387..4066620 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY19_RS19960 (4061745) 4061745..4063031 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NBY19_RS19965 (4063031) 4063031..4064020 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NBY19_RS19970 (4064017) 4064017..4064838 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NBY19_RS19975 (4064841) 4064841..4065218 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NBY19_RS19980 (4065225) 4065225..4066073 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NBY19_RS19985 (4066070) 4066070..4066384 - 315 WP_001160966.1 CcdB family protein Toxin
NBY19_RS19990 (4066387) 4066387..4066620 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NBY19_RS19995 (4066706) 4066706..4067185 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NBY19_RS20000 (4067377) 4067377..4069239 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
NBY19_RS20005 (4069232) 4069232..4069762 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NBY19_RS20010 (4069870) 4069870..4071201 - 1332 WP_001183207.1 MFS transporter -
NBY19_RS20015 (4071260) 4071260..4071547 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T247044 WP_001160966.1 NZ_CP098203:c4066384-4066070 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT247044 WP_000125566.1 NZ_CP098203:c4066620-4066387 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References