Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3653242..3653860 | Replicon | chromosome |
| Accession | NZ_CP098203 | ||
| Organism | Escherichia coli strain Z0117EC0055 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NBY19_RS18035 | Protein ID | WP_001291435.1 |
| Coordinates | 3653642..3653860 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NBY19_RS18030 | Protein ID | WP_000344800.1 |
| Coordinates | 3653242..3653616 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY19_RS18020 (3648331) | 3648331..3649524 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NBY19_RS18025 (3649547) | 3649547..3652696 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| NBY19_RS18030 (3653242) | 3653242..3653616 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY19_RS18035 (3653642) | 3653642..3653860 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NBY19_RS18040 (3654033) | 3654033..3654584 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| NBY19_RS18045 (3654700) | 3654700..3655170 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NBY19_RS18050 (3655334) | 3655334..3656884 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NBY19_RS18055 (3656926) | 3656926..3657279 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
| NBY19_RS18065 (3657658) | 3657658..3657969 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| NBY19_RS18070 (3658000) | 3658000..3658572 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247042 WP_001291435.1 NZ_CP098203:3653642-3653860 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247042 WP_000344800.1 NZ_CP098203:3653242-3653616 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |