Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1925008..1925839 Replicon chromosome
Accession NZ_CP098203
Organism Escherichia coli strain Z0117EC0055

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NBY19_RS09075 Protein ID WP_000854814.1
Coordinates 1925008..1925382 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag NBY19_RS09080 Protein ID WP_001546021.1
Coordinates 1925471..1925839 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY19_RS09040 (1921003) 1921003..1921332 + 330 WP_000450409.1 DUF496 family protein -
NBY19_RS09045 (1921433) 1921433..1921756 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
NBY19_RS09050 (1921735) 1921735..1921815 + 81 WP_023441679.1 hypothetical protein -
NBY19_RS09055 (1922026) 1922026..1923567 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NBY19_RS09060 (1923582) 1923582..1924328 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NBY19_RS09065 (1924691) 1924691..1924771 - 81 Protein_1779 hypothetical protein -
NBY19_RS09070 (1924817) 1924817..1925011 - 195 WP_000988601.1 DUF5983 family protein -
NBY19_RS09075 (1925008) 1925008..1925382 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NBY19_RS09080 (1925471) 1925471..1925839 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NBY19_RS09085 (1925919) 1925919..1926140 - 222 WP_000692323.1 DUF987 domain-containing protein -
NBY19_RS09090 (1926203) 1926203..1926679 - 477 WP_001186773.1 RadC family protein -
NBY19_RS09095 (1926695) 1926695..1927168 - 474 WP_001385393.1 antirestriction protein -
NBY19_RS09100 (1927431) 1927431..1928252 - 822 WP_001234710.1 DUF932 domain-containing protein -
NBY19_RS09105 (1928473) 1928473..1928883 - 411 WP_000846704.1 hypothetical protein -
NBY19_RS09110 (1928899) 1928899..1929576 - 678 WP_001362823.1 hypothetical protein -
NBY19_RS09115 (1929712) 1929712..1930782 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T247034 WP_000854814.1 NZ_CP098203:c1925382-1925008 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT247034 WP_001546021.1 NZ_CP098203:c1925839-1925471 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References