Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 864349..865183 | Replicon | chromosome |
| Accession | NZ_CP098203 | ||
| Organism | Escherichia coli strain Z0117EC0055 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NBY19_RS04195 | Protein ID | WP_001546109.1 |
| Coordinates | 864349..864726 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | NBY19_RS04200 | Protein ID | WP_001546108.1 |
| Coordinates | 864803..865183 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY19_RS04165 (860743) | 860743..860913 | - | 171 | Protein_820 | IS110 family transposase | - |
| NBY19_RS04170 (861330) | 861330..862264 | - | 935 | Protein_821 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NBY19_RS04175 (862257) | 862257..862652 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| NBY19_RS04180 (862721) | 862721..863566 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| NBY19_RS04185 (863651) | 863651..863848 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| NBY19_RS04190 (863865) | 863865..864352 | - | 488 | Protein_825 | DUF5983 family protein | - |
| NBY19_RS04195 (864349) | 864349..864726 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| NBY19_RS04200 (864803) | 864803..865183 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY19_RS04205 (865233) | 865233..865877 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| NBY19_RS04210 (865896) | 865896..866117 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NBY19_RS04215 (866186) | 866186..866662 | - | 477 | WP_001424026.1 | RadC family protein | - |
| NBY19_RS04220 (866678) | 866678..867163 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| NBY19_RS04225 (867218) | 867218..868036 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NBY19_RS04230 (868136) | 868136..868369 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NBY19_RS04235 (868448) | 868448..868903 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T247031 WP_001546109.1 NZ_CP098203:c864726-864349 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT247031 WP_001546108.1 NZ_CP098203:c865183-864803 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|