Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 332912..333712 | Replicon | chromosome |
Accession | NZ_CP098203 | ||
Organism | Escherichia coli strain Z0117EC0055 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | NBY19_RS01560 | Protein ID | WP_000342452.1 |
Coordinates | 333185..333712 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | NBY19_RS01555 | Protein ID | WP_001277107.1 |
Coordinates | 332912..333178 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY19_RS01535 (328571) | 328571..329239 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
NBY19_RS01540 (329232) | 329232..330290 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
NBY19_RS01545 (330535) | 330535..331389 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NBY19_RS01550 (331660) | 331660..332763 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NBY19_RS01555 (332912) | 332912..333178 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NBY19_RS01560 (333185) | 333185..333712 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NBY19_RS01565 (333709) | 333709..334092 | - | 384 | WP_000778796.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NBY19_RS01570 (334515) | 334515..335624 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NBY19_RS01575 (335672) | 335672..336598 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NBY19_RS01580 (336595) | 336595..337872 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
NBY19_RS01585 (337869) | 337869..338636 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T247028 WP_000342452.1 NZ_CP098203:333185-333712 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |