Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 15028..15653 | Replicon | plasmid pZ0117EC0056-1 |
| Accession | NZ_CP098202 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NBY20_RS24865 | Protein ID | WP_000911324.1 |
| Coordinates | 15255..15653 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | NBY20_RS24860 | Protein ID | WP_000450532.1 |
| Coordinates | 15028..15255 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS24860 (15028) | 15028..15255 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NBY20_RS24865 (15255) | 15255..15653 | + | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY20_RS24870 (15662) | 15662..16825 | - | 1164 | Protein_20 | type IV secretion system DNA-binding domain-containing protein | - |
| NBY20_RS24875 (16878) | 16878..17582 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NBY20_RS24880 (17626) | 17626..17724 | + | 99 | Protein_22 | complement resistance protein TraT | - |
| NBY20_RS24885 (17977) | 17977..18975 | + | 999 | Protein_23 | type IV secretion system DNA-binding domain-containing protein | - |
| NBY20_RS24890 (19038) | 19038..19742 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NBY20_RS24895 (19748) | 19748..20172 | + | 425 | Protein_25 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD / mph(A) / sul1 / qacE / dfrA5 | - | 1..78537 | 78537 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T247024 WP_000911324.1 NZ_CP098202:15255-15653 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|