Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 3264..3811 Replicon plasmid pZ0117EC0056-1
Accession NZ_CP098202
Organism Escherichia coli strain Z0117EC0056

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NBY20_RS24790 Protein ID WP_244449344.1
Coordinates 3264..3542 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E2GHF7
Locus tag NBY20_RS24795 Protein ID WP_012881119.1
Coordinates 3542..3811 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY20_RS24770 (23) 23..576 + 554 Protein_0 TOBE domain-containing protein -
NBY20_RS24775 (666) 666..1736 + 1071 Protein_1 maltoporin LamB -
NBY20_RS24780 (1771) 1771..2253 - 483 WP_001311056.1 hypothetical protein -
NBY20_RS24785 (2370) 2370..3218 - 849 WP_012881117.1 3'-5' exonuclease -
NBY20_RS24790 (3264) 3264..3542 - 279 WP_244449344.1 type II toxin-antitoxin system toxin YacB Toxin
NBY20_RS24795 (3542) 3542..3811 - 270 WP_012881119.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NBY20_RS24800 (3866) 3866..4024 - 159 WP_166740453.1 hypothetical protein -
NBY20_RS24805 (4726) 4726..5583 - 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
NBY20_RS24810 (5576) 5576..5623 - 48 WP_077822033.1 hypothetical protein -
NBY20_RS24815 (5614) 5614..5850 + 237 WP_223368648.1 replication protein RepA -
NBY20_RS24820 (5876) 5876..6136 - 261 WP_000083818.1 replication regulatory protein RepA -
NBY20_RS24825 (6375) 6375..6948 - 574 Protein_11 DUF2726 domain-containing protein -
NBY20_RS24830 (6986) 6986..7195 - 210 WP_001333231.1 hemolysin expression modulator Hha -
NBY20_RS24835 (7241) 7241..7702 - 462 WP_001233871.1 thermonuclease family protein -
NBY20_RS24840 (7945) 7945..8157 - 213 WP_012311405.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD / mph(A) / sul1 / qacE / dfrA5 - 1..78537 78537


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10744.34 Da        Isoelectric Point: 8.4615

>T247023 WP_244449344.1 NZ_CP098202:c3542-3264 [Escherichia coli]
MEIFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10206.54 Da        Isoelectric Point: 8.8735

>AT247023 WP_012881119.1 NZ_CP098202:c3811-3542 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EISRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y1YSD8

References