Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4957858..4958470 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | NBY20_RS23900 | Protein ID | WP_000833473.1 |
Coordinates | 4958285..4958470 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | NBY20_RS23895 | Protein ID | WP_000499744.1 |
Coordinates | 4957858..4958268 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS23880 (4953370) | 4953370..4954185 | - | 816 | WP_000891823.1 | AraC family transcriptional regulator | - |
NBY20_RS23885 (4954411) | 4954411..4955811 | + | 1401 | WP_000204811.1 | MFS transporter | - |
NBY20_RS23890 (4955822) | 4955822..4957786 | + | 1965 | WP_001551835.1 | glycoside hydrolase family 127 protein | - |
NBY20_RS23895 (4957858) | 4957858..4958268 | - | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NBY20_RS23900 (4958285) | 4958285..4958470 | - | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NBY20_RS23905 (4958739) | 4958739..4960277 | - | 1539 | WP_001551836.1 | aldehyde dehydrogenase AldB | - |
NBY20_RS23910 (4960478) | 4960478..4961629 | - | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T247022 WP_000833473.1 NZ_CP098201:c4958470-4958285 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT247022 WP_000499744.1 NZ_CP098201:c4958268-4957858 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|