Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4284024..4284856 Replicon chromosome
Accession NZ_CP098201
Organism Escherichia coli strain Z0117EC0056

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag NBY20_RS20615 Protein ID WP_000854753.1
Coordinates 4284482..4284856 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NQ68
Locus tag NBY20_RS20610 Protein ID WP_001540478.1
Coordinates 4284024..4284392 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY20_RS20575 (4279854) 4279854..4280534 + 681 WP_001278649.1 WYL domain-containing protein -
NBY20_RS20580 (4280685) 4280685..4281362 + 678 WP_001596606.1 hypothetical protein -
NBY20_RS20585 (4281368) 4281368..4281601 + 234 WP_001278283.1 DUF905 family protein -
NBY20_RS20590 (4281691) 4281691..4282509 + 819 WP_001234682.1 DUF932 domain-containing protein -
NBY20_RS20595 (4282600) 4282600..4283085 + 486 WP_000214398.1 antirestriction protein -
NBY20_RS20600 (4283101) 4283101..4283577 + 477 WP_001313574.1 RadC family protein -
NBY20_RS20605 (4283640) 4283640..4283861 + 222 WP_000692311.1 DUF987 domain-containing protein -
NBY20_RS20610 (4284024) 4284024..4284392 + 369 WP_001540478.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY20_RS20615 (4284482) 4284482..4284856 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
NBY20_RS20620 (4284853) 4284853..4285341 + 489 WP_000777545.1 DUF5983 family protein -
NBY20_RS20625 (4285353) 4285353..4285550 + 198 WP_000839281.1 DUF957 domain-containing protein -
NBY20_RS20630 (4285647) 4285647..4285934 + 288 Protein_4030 DUF4942 domain-containing protein -
NBY20_RS20635 (4286006) 4286006..4287010 + 1005 WP_001179707.1 IS110-like element ISSfl8 family transposase -
NBY20_RS20640 (4287292) 4287292..4287573 + 282 Protein_4032 DUF4942 domain-containing protein -
NBY20_RS20645 (4287916) 4287916..4288086 + 171 Protein_4033 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 4212887..4287700 74813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T247020 WP_000854753.1 NZ_CP098201:4284482-4284856 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13652.53 Da        Isoelectric Point: 7.8398

>AT247020 WP_001540478.1 NZ_CP098201:4284024-4284392 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB S1NQ68

References