Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4136166..4136820 | Replicon | chromosome |
| Accession | NZ_CP098201 | ||
| Organism | Escherichia coli strain Z0117EC0056 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NBY20_RS19835 | Protein ID | WP_000244781.1 |
| Coordinates | 4136166..4136573 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0V9GG32 |
| Locus tag | NBY20_RS19840 | Protein ID | WP_001564007.1 |
| Coordinates | 4136554..4136820 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY20_RS19815 (4132123) | 4132123..4133856 | - | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY20_RS19820 (4133862) | 4133862..4134572 | - | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY20_RS19825 (4134597) | 4134597..4135493 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NBY20_RS19830 (4135605) | 4135605..4136126 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NBY20_RS19835 (4136166) | 4136166..4136573 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NBY20_RS19840 (4136554) | 4136554..4136820 | - | 267 | WP_001564007.1 | FAD assembly factor SdhE | Antitoxin |
| NBY20_RS19845 (4137063) | 4137063..4138043 | + | 981 | WP_001564008.1 | tRNA-modifying protein YgfZ | - |
| NBY20_RS19850 (4138120) | 4138120..4138779 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NBY20_RS19855 (4138943) | 4138943..4139254 | - | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY20_RS19860 (4139299) | 4139299..4140732 | + | 1434 | WP_001564009.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T247019 WP_000244781.1 NZ_CP098201:c4136573-4136166 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PAM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9GG32 |